SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modeling Report

Model Building Report

This document lists the results for the homology modeling project "p185 M1" submitted to SWISS-MODEL workspace on Aug. 21, 2015, 3:08 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2015-08-12, PDB release 2015-08-07) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 385 templates were found (Table T2).

Models

The following model was built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN4
	PDB	ProMod Version 3.70.	MONOMER	1 x NAG: SUGAR (N-ACETYL-D-GLUCOSAMINE);	0.99	-1.10

QMEAN4	-1.10
Cβ	1.52
All Atom	-2.32
Solvation	-0.64
Torsion	-1.49

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
3be1.1.A	99.80	hetero-oligomer	HHblits	X-ray	2.90Å	0.62	2 - 507	1.00	Receptor tyrosine-protein kinase erbB-2

Ligand	Added to Model	Description
NAG	✓	SUGAR (N-ACETYL-D-GLUCOSAMINE)
MES	✕ - Binding site not conserved.	2-(N-MORPHOLINO)-ETHANESULFONIC ACID
NAG	✕ - Not biologically relevant.	SUGAR (N-ACETYL-D-GLUCOSAMINE)

Target    MTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRI
3be1.1.A  -TQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRI

Target    VRGTQLFEDNYALAVLDNGDPLNDTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLAL
3be1.1.A  VRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLAL

Target    TLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCA-GCTGPKHSDCLACLHFNHS
3be1.1.A  TLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHS

Target    GICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARV
3be1.1.A  GICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARV

Target    CYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFE-LEEITGYLYISAWPDSLPD
3be1.1.A  CYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPD

Target    LSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPE
3be1.1.A  LSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPE

Target    DECVGEGLACHQLCARGHCWGPGPTQCVN
3be1.1.A  DECVGEGLACHQLCARGHCWGPGPTQCVN

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2015-08-12, last included PDB release: 2015-08-07).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 39 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 148 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using Promod-II. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodeled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod-II (Guex, et al., 1997) does not give satisfactory results, an alternative model is built with MODELLER (Sali, et al., 1993).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modeling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypetide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD
PLNDTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCA
GGCARCKGPLPTDCCHEQCAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEV
TAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFELEEITGYLYISAWPDSLPDLS
VFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGP
GPTQCVN

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
3wlw.1.A	99.80	hetero-oligomer	HHblits	X-ray	3.09Å	0.62	1.00	Receptor tyrosine-protein kinase erbB-2
3wsq.1.A	99.80	hetero-oligomer	HHblits	X-ray	3.50Å	0.62	1.00	Receptor tyrosine-protein kinase erbB-2
3n85.1.G	99.80	hetero-oligomer	HHblits	X-ray	3.20Å	0.62	1.00	Receptor tyrosine-protein kinase erbB-2
1s78.1.A	99.80	hetero-oligomer	HHblits	X-ray	3.25Å	0.62	1.00	Receptor protein-tyrosine kinase erbB-2
3mzw.1.A	99.80	hetero-oligomer	HHblits	X-ray	2.90Å	0.62	1.00	Tyrosine kinase-type cell surface receptor HER2
3be1.1.A	99.80	hetero-oligomer	HHblits	X-ray	2.90Å	0.62	1.00	Receptor tyrosine-protein kinase erbB-2
1n8z.1.C	99.80	hetero-oligomer	HHblits	X-ray	2.52Å	0.62	1.00	Receptor protein-tyrosine kinase erbB-2
3be1.1.A	99.80	hetero-oligomer	BLAST	X-ray	2.90Å	0.62	1.00	Receptor tyrosine-protein kinase erbB-2
3mzw.1.A	99.80	hetero-oligomer	BLAST	X-ray	2.90Å	0.62	1.00	Tyrosine kinase-type cell surface receptor HER2
1s78.1.A	99.80	hetero-oligomer	BLAST	X-ray	3.25Å	0.62	1.00	Receptor protein-tyrosine kinase erbB-2
3n85.1.G	99.80	hetero-oligomer	BLAST	X-ray	3.20Å	0.62	1.00	Receptor tyrosine-protein kinase erbB-2
1n8z.1.C	99.80	hetero-oligomer	BLAST	X-ray	2.52Å	0.62	1.00	Receptor protein-tyrosine kinase erbB-2
3wsq.1.A	99.80	hetero-oligomer	BLAST	X-ray	3.50Å	0.62	1.00	Receptor tyrosine-protein kinase erbB-2
3wlw.1.A	99.80	hetero-oligomer	BLAST	X-ray	3.09Å	0.62	1.00	Receptor tyrosine-protein kinase erbB-2
2a91.1.A	99.41	monomer	HHblits	X-ray	2.50Å	0.62	1.00	Receptor tyrosine-protein kinase erbB-2
2a91.1.A	99.41	monomer	BLAST	X-ray	2.50Å	0.62	1.00	Receptor tyrosine-protein kinase erbB-2
1n8y.1.A	85.77	monomer	BLAST	X-ray	2.40Å	0.57	1.00	protooncoprotein
1n8y.1.A	85.57	monomer	HHblits	X-ray	2.40Å	0.57	1.00	protooncoprotein
1yy9.1.A	44.65	hetero-oligomer	HHblits	X-ray	2.61Å	0.43	0.98	Epidermal Growth Factor Receptor
4krp.1.A	44.65	hetero-oligomer	HHblits	X-ray	2.82Å	0.43	0.98	Epidermal growth factor receptor
3qwq.1.A	44.65	hetero-oligomer	HHblits	X-ray	2.75Å	0.43	0.98	Epidermal growth factor receptor
1nql.1.A	44.65	hetero-oligomer	HHblits	X-ray	2.80Å	0.43	0.98	epidermal growth factor receptor
3njp.1.A	44.65	hetero-oligomer	HHblits	X-ray	3.30Å	0.43	0.98	Epidermal growth factor receptor
3njp.1.B	44.65	hetero-oligomer	HHblits	X-ray	3.30Å	0.43	0.98	Epidermal growth factor receptor
4kro.1.A	44.65	hetero-oligomer	HHblits	X-ray	3.05Å	0.43	0.98	Epidermal growth factor receptor
3b2v.1.C	44.65	hetero-oligomer	HHblits	X-ray	3.30Å	0.43	0.98	Epidermal growth factor receptor
1mox.1.B	44.65	hetero-oligomer	HHblits	X-ray	2.50Å	0.43	0.98	Epidermal Growth Factor Receptor
1mox.1.A	44.65	hetero-oligomer	HHblits	X-ray	2.50Å	0.43	0.98	Epidermal Growth Factor Receptor
1ivo.1.A	44.65	hetero-oligomer	HHblits	X-ray	3.30Å	0.43	0.98	Epidermal Growth Factor Receptor
1ivo.1.B	44.65	hetero-oligomer	HHblits	X-ray	3.30Å	0.43	0.98	Epidermal Growth Factor Receptor
1yy9.1.A	44.74	hetero-oligomer	BLAST	X-ray	2.61Å	0.43	0.97	Epidermal Growth Factor Receptor
4krp.1.A	44.74	hetero-oligomer	BLAST	X-ray	2.82Å	0.43	0.97	Epidermal growth factor receptor
1nql.1.A	44.74	hetero-oligomer	BLAST	X-ray	2.80Å	0.43	0.97	epidermal growth factor receptor
3njp.1.A	44.74	hetero-oligomer	BLAST	X-ray	3.30Å	0.43	0.97	Epidermal growth factor receptor
3njp.1.B	44.74	hetero-oligomer	BLAST	X-ray	3.30Å	0.43	0.97	Epidermal growth factor receptor
3qwq.1.A	44.74	hetero-oligomer	BLAST	X-ray	2.75Å	0.43	0.97	Epidermal growth factor receptor
1ivo.1.A	44.74	hetero-oligomer	BLAST	X-ray	3.30Å	0.43	0.97	Epidermal Growth Factor Receptor
1ivo.1.B	44.74	hetero-oligomer	BLAST	X-ray	3.30Å	0.43	0.97	Epidermal Growth Factor Receptor
3b2v.1.C	44.74	hetero-oligomer	BLAST	X-ray	3.30Å	0.43	0.97	Epidermal growth factor receptor
4kro.1.A	44.74	hetero-oligomer	BLAST	X-ray	3.05Å	0.43	0.97	Epidermal growth factor receptor
1mox.1.A	44.74	hetero-oligomer	BLAST	X-ray	2.50Å	0.43	0.97	Epidermal Growth Factor Receptor
1mox.1.B	44.74	hetero-oligomer	BLAST	X-ray	2.50Å	0.43	0.97	Epidermal Growth Factor Receptor
2ahx.1.A	45.93	monomer	BLAST	X-ray	2.40Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
2ahx.2.A	45.93	monomer	BLAST	X-ray	2.40Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u7u.4.A	45.93	hetero-oligomer	BLAST	X-ray	3.03Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u7u.3.A	45.93	hetero-oligomer	BLAST	X-ray	3.03Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u7u.2.A	45.93	hetero-oligomer	BLAST	X-ray	3.03Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u7u.1.A	45.93	hetero-oligomer	BLAST	X-ray	3.03Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u9u.4.A	45.93	monomer	BLAST	X-ray	3.42Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u9u.3.A	45.93	monomer	BLAST	X-ray	3.42Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u2p.1.A	45.93	monomer	BLAST	X-ray	2.57Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u2p.1.A	45.64	monomer	HHblits	X-ray	2.57Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u7u.4.A	45.64	hetero-oligomer	HHblits	X-ray	3.03Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u7u.3.A	45.64	hetero-oligomer	HHblits	X-ray	3.03Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
2ahx.2.A	45.64	monomer	HHblits	X-ray	2.40Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
2ahx.1.A	45.64	monomer	HHblits	X-ray	2.40Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u9u.3.A	45.64	monomer	HHblits	X-ray	3.42Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u7u.2.A	45.64	hetero-oligomer	HHblits	X-ray	3.03Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u7u.1.A	45.64	hetero-oligomer	HHblits	X-ray	3.03Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
3u9u.4.A	45.64	monomer	HHblits	X-ray	3.42Å	0.43	0.97	Receptor tyrosine-protein kinase erbB-4
4p59.1.A	45.79	hetero-oligomer	BLAST	X-ray	3.40Å	0.43	0.96	Receptor tyrosine-protein kinase erbB-3
4leo.1.C	45.79	hetero-oligomer	BLAST	X-ray	2.64Å	0.43	0.96	Receptor tyrosine-protein kinase erbB-3
3p11.1.C	45.79	hetero-oligomer	BLAST	X-ray	3.70Å	0.43	0.96	Receptor tyrosine-protein kinase erbB-3
1m6b.2.A	45.59	monomer	BLAST	X-ray	2.60Å	0.43	0.96	Receptor protein-tyrosine kinase erbB-3
1m6b.1.A	45.59	monomer	BLAST	X-ray	2.60Å	0.43	0.96	Receptor protein-tyrosine kinase erbB-3
4leo.1.C	44.67	hetero-oligomer	HHblits	X-ray	2.64Å	0.43	0.96	Receptor tyrosine-protein kinase erbB-3
4p59.1.A	44.47	hetero-oligomer	HHblits	X-ray	3.40Å	0.43	0.96	Receptor tyrosine-protein kinase erbB-3
3p11.1.C	44.47	hetero-oligomer	HHblits	X-ray	3.70Å	0.43	0.96	Receptor tyrosine-protein kinase erbB-3
1m6b.2.A	44.26	monomer	HHblits	X-ray	2.60Å	0.43	0.96	Receptor protein-tyrosine kinase erbB-3
1m6b.1.A	44.26	monomer	HHblits	X-ray	2.60Å	0.43	0.96	Receptor protein-tyrosine kinase erbB-3
3ltf.1.A	38.61	hetero-oligomer	HHblits	X-ray	3.20Å	0.40	0.93	Epidermal growth factor receptor
3ltf.1.B	38.61	hetero-oligomer	HHblits	X-ray	3.20Å	0.40	0.93	Epidermal growth factor receptor
3i2t.1.A	38.40	homo-dimer	HHblits	X-ray	2.70Å	0.40	0.93	Epidermal growth factor receptor, isoform A
3i2t.1.A	40.09	homo-dimer	BLAST	X-ray	2.70Å	0.41	0.92	Epidermal growth factor receptor, isoform A
3ltf.1.B	40.09	hetero-oligomer	BLAST	X-ray	3.20Å	0.41	0.92	Epidermal growth factor receptor
3ltf.1.A	40.09	hetero-oligomer	BLAST	X-ray	3.20Å	0.41	0.92	Epidermal growth factor receptor
3w14.1.E	29.11	hetero-oligomer	HHblits	X-ray	4.40Å	0.34	0.84	INSULIN RECEPTOR DOMAINS L1-CR-L2-(FNIII-1)-ALPHACT
2hr7.1.A	29.01	homo-dimer	HHblits	X-ray	2.32Å	0.34	0.84	Insulin receptor
2hr7.1.B	29.01	homo-dimer	HHblits	X-ray	2.32Å	0.34	0.84	Insulin receptor
1igr.1.A	25.06	monomer	HHblits	X-ray	2.60Å	0.34	0.83	INSULIN-LIKE GROWTH FACTOR RECEPTOR 1
3loh.1.E	30.58	hetero-oligomer	HHblits	X-ray	3.80Å	0.35	0.81	Insulin receptor
2dtg.1.E	30.49	hetero-oligomer	HHblits	X-ray	3.80Å	0.35	0.81	Insulin receptor
3w14.1.E	34.82	hetero-oligomer	BLAST	X-ray	4.40Å	0.37	0.75	INSULIN RECEPTOR DOMAINS L1-CR-L2-(FNIII-1)-ALPHACT
3loh.1.E	34.82	hetero-oligomer	BLAST	X-ray	3.80Å	0.37	0.75	Insulin receptor
2dtg.1.E	34.82	hetero-oligomer	BLAST	X-ray	3.80Å	0.37	0.75	Insulin receptor
2hr7.1.A	34.82	homo-dimer	BLAST	X-ray	2.32Å	0.37	0.75	Insulin receptor
2hr7.1.B	34.82	homo-dimer	BLAST	X-ray	2.32Å	0.37	0.75	Insulin receptor
1igr.1.A	29.80	monomer	BLAST	X-ray	2.60Å	0.36	0.60	INSULIN-LIKE GROWTH FACTOR RECEPTOR 1
1ivo.1.A	29.30	hetero-oligomer	HHblits	X-ray	3.30Å	0.36	0.54	Epidermal Growth Factor Receptor
1ivo.1.B	29.30	hetero-oligomer	HHblits	X-ray	3.30Å	0.36	0.54	Epidermal Growth Factor Receptor
3w11.1.E	28.83	hetero-oligomer	HHblits	X-ray	3.90Å	0.35	0.54	Insulin receptor domains L1-CR
4oga.1.E	29.15	hetero-oligomer	HHblits	X-ray	3.50Å	0.36	0.53	Insulin receptor domains L1-CR
4xss.1.B	29.15	hetero-oligomer	HHblits	X-ray	3.00Å	0.36	0.53	Insulin receptor
4xst.2.C	29.15	hetero-oligomer	HHblits	X-ray	3.00Å	0.36	0.53	Insulin receptor
4hrl.1.A	97.96	hetero-oligomer	BLAST	X-ray	2.55Å	0.60	0.39	Receptor tyrosine-protein kinase erbB-2
4hrl.1.A	97.96	hetero-oligomer	HHblits	X-ray	2.55Å	0.60	0.39	Receptor tyrosine-protein kinase erbB-2
3h3b.1.A	99.48	hetero-oligomer	HHblits	X-ray	2.45Å	0.61	0.38	Receptor tyrosine-protein kinase erbB-2
3h3b.2.A	99.48	hetero-oligomer	HHblits	X-ray	2.45Å	0.61	0.38	Receptor tyrosine-protein kinase erbB-2
1nql.1.A	29.43	hetero-oligomer	HHblits	X-ray	2.80Å	0.36	0.52	epidermal growth factor receptor
3qwq.1.A	29.06	hetero-oligomer	HHblits	X-ray	2.75Å	0.36	0.52	Epidermal growth factor receptor
4kro.1.A	29.06	hetero-oligomer	HHblits	X-ray	3.05Å	0.36	0.52	Epidermal growth factor receptor
3b2v.1.C	29.06	hetero-oligomer	HHblits	X-ray	3.30Å	0.36	0.52	Epidermal growth factor receptor
3njp.1.B	29.17	hetero-oligomer	HHblits	X-ray	3.30Å	0.36	0.52	Epidermal growth factor receptor
3njp.1.A	29.17	hetero-oligomer	HHblits	X-ray	3.30Å	0.36	0.52	Epidermal growth factor receptor
1yy9.1.A	28.68	hetero-oligomer	HHblits	X-ray	2.61Å	0.35	0.52	Epidermal Growth Factor Receptor
4krp.1.A	28.90	hetero-oligomer	HHblits	X-ray	2.82Å	0.36	0.52	Epidermal growth factor receptor
3mzw.1.A	26.04	hetero-oligomer	HHblits	X-ray	2.90Å	0.34	0.52	Tyrosine kinase-type cell surface receptor HER2
3n85.1.G	26.04	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.52	Receptor tyrosine-protein kinase erbB-2
1s78.1.A	26.04	hetero-oligomer	HHblits	X-ray	3.25Å	0.34	0.52	Receptor protein-tyrosine kinase erbB-2
3be1.1.A	26.04	hetero-oligomer	HHblits	X-ray	2.90Å	0.34	0.52	Receptor tyrosine-protein kinase erbB-2
4leo.1.C	25.48	hetero-oligomer	HHblits	X-ray	2.64Å	0.35	0.52	Receptor tyrosine-protein kinase erbB-3
4p59.1.A	25.57	hetero-oligomer	HHblits	X-ray	3.40Å	0.35	0.52	Receptor tyrosine-protein kinase erbB-3
1m6b.1.A	25.57	monomer	HHblits	X-ray	2.60Å	0.35	0.52	Receptor protein-tyrosine kinase erbB-3
1m6b.2.A	25.57	monomer	HHblits	X-ray	2.60Å	0.35	0.52	Receptor protein-tyrosine kinase erbB-3
1nql.1.A	31.33	hetero-oligomer	BLAST	X-ray	2.80Å	0.37	0.49	epidermal growth factor receptor
1yy9.1.A	30.92	hetero-oligomer	BLAST	X-ray	2.61Å	0.37	0.49	Epidermal Growth Factor Receptor
3b2v.1.C	31.05	hetero-oligomer	BLAST	X-ray	3.30Å	0.37	0.49	Epidermal growth factor receptor
4kro.1.A	31.05	hetero-oligomer	BLAST	X-ray	3.05Å	0.37	0.49	Epidermal growth factor receptor
3qwq.1.A	31.05	hetero-oligomer	BLAST	X-ray	2.75Å	0.37	0.49	Epidermal growth factor receptor
3be1.1.A	30.93	hetero-oligomer	BLAST	X-ray	2.90Å	0.37	0.47	Receptor tyrosine-protein kinase erbB-2
3mzw.1.A	30.93	hetero-oligomer	BLAST	X-ray	2.90Å	0.37	0.47	Tyrosine kinase-type cell surface receptor HER2
1s78.1.A	30.93	hetero-oligomer	BLAST	X-ray	3.25Å	0.37	0.47	Receptor protein-tyrosine kinase erbB-2
3n85.1.G	30.93	hetero-oligomer	BLAST	X-ray	3.20Å	0.37	0.47	Receptor tyrosine-protein kinase erbB-2
1n8y.1.A	28.09	monomer	HHblits	X-ray	2.40Å	0.35	0.46	protooncoprotein
1n8z.1.C	26.38	hetero-oligomer	HHblits	X-ray	2.52Å	0.35	0.46	Receptor protein-tyrosine kinase erbB-2
4leo.1.C	30.22	hetero-oligomer	BLAST	X-ray	2.64Å	0.37	0.44	Receptor tyrosine-protein kinase erbB-3
4p59.1.A	30.22	hetero-oligomer	BLAST	X-ray	3.40Å	0.37	0.44	Receptor tyrosine-protein kinase erbB-3
1m6b.1.A	30.22	monomer	BLAST	X-ray	2.60Å	0.37	0.44	Receptor protein-tyrosine kinase erbB-3
1m6b.2.A	30.22	monomer	BLAST	X-ray	2.60Å	0.37	0.44	Receptor protein-tyrosine kinase erbB-3
3u9u.3.A	26.09	monomer	HHblits	X-ray	3.42Å	0.35	0.45	Receptor tyrosine-protein kinase erbB-4
3u9u.4.A	26.09	monomer	HHblits	X-ray	3.42Å	0.35	0.45	Receptor tyrosine-protein kinase erbB-4
3u7u.4.A	26.09	hetero-oligomer	HHblits	X-ray	3.03Å	0.35	0.45	Receptor tyrosine-protein kinase erbB-4
3u7u.3.A	26.09	hetero-oligomer	HHblits	X-ray	3.03Å	0.35	0.45	Receptor tyrosine-protein kinase erbB-4
3u7u.2.A	26.09	hetero-oligomer	HHblits	X-ray	3.03Å	0.35	0.45	Receptor tyrosine-protein kinase erbB-4
3u7u.1.A	26.09	hetero-oligomer	HHblits	X-ray	3.03Å	0.35	0.45	Receptor tyrosine-protein kinase erbB-4
2ahx.1.A	26.09	monomer	HHblits	X-ray	2.40Å	0.35	0.45	Receptor tyrosine-protein kinase erbB-4
2ahx.2.A	26.09	monomer	HHblits	X-ray	2.40Å	0.35	0.45	Receptor tyrosine-protein kinase erbB-4
3ltf.1.A	27.60	hetero-oligomer	HHblits	X-ray	3.20Å	0.36	0.44	Epidermal growth factor receptor
3ltf.1.B	27.60	hetero-oligomer	HHblits	X-ray	3.20Å	0.36	0.44	Epidermal growth factor receptor
3njp.1.A	33.65	hetero-oligomer	BLAST	X-ray	3.30Å	0.38	0.42	Epidermal growth factor receptor
3njp.1.B	33.65	hetero-oligomer	BLAST	X-ray	3.30Å	0.38	0.42	Epidermal growth factor receptor
4krp.1.A	33.65	hetero-oligomer	BLAST	X-ray	2.82Å	0.38	0.42	Epidermal growth factor receptor
1ivo.1.A	33.65	hetero-oligomer	BLAST	X-ray	3.30Å	0.38	0.42	Epidermal Growth Factor Receptor
1ivo.1.B	33.65	hetero-oligomer	BLAST	X-ray	3.30Å	0.38	0.42	Epidermal Growth Factor Receptor
3w11.1.E	35.58	hetero-oligomer	BLAST	X-ray	3.90Å	0.39	0.41	Insulin receptor domains L1-CR
4xst.2.C	35.58	hetero-oligomer	BLAST	X-ray	3.00Å	0.39	0.41	Insulin receptor
4oga.1.E	35.58	hetero-oligomer	BLAST	X-ray	3.50Å	0.39	0.41	Insulin receptor domains L1-CR
4xss.1.B	35.58	hetero-oligomer	BLAST	X-ray	3.00Å	0.39	0.41	Insulin receptor
3ltf.1.B	30.48	hetero-oligomer	BLAST	X-ray	3.20Å	0.37	0.41	Epidermal growth factor receptor
3ltf.1.A	30.48	hetero-oligomer	BLAST	X-ray	3.20Å	0.37	0.41	Epidermal growth factor receptor
1n8y.1.A	33.50	monomer	BLAST	X-ray	2.40Å	0.39	0.39	protooncoprotein
3i2t.1.A	28.02	homo-dimer	HHblits	X-ray	2.70Å	0.36	0.41	Epidermal growth factor receptor, isoform A
3wlw.1.A	26.54	hetero-oligomer	HHblits	X-ray	3.09Å	0.34	0.42	Receptor tyrosine-protein kinase erbB-2
3wsq.1.A	26.54	hetero-oligomer	HHblits	X-ray	3.50Å	0.34	0.42	Receptor tyrosine-protein kinase erbB-2
3p0y.1.A	40.31	hetero-oligomer	HHblits	X-ray	1.80Å	0.41	0.38	Epidermal growth factor receptor
4krm.1.A	40.53	hetero-oligomer	HHblits	X-ray	2.65Å	0.41	0.37	Epidermal growth factor receptor
4krm.1.A	40.53	hetero-oligomer	BLAST	X-ray	2.65Å	0.41	0.37	Epidermal growth factor receptor
3b2u.5.C	40.53	hetero-oligomer	BLAST	X-ray	2.58Å	0.41	0.37	Epidermal growth factor receptor
3b2u.5.C	40.53	hetero-oligomer	HHblits	X-ray	2.58Å	0.41	0.37	Epidermal growth factor receptor
3p0y.1.A	40.53	hetero-oligomer	BLAST	X-ray	1.80Å	0.41	0.37	Epidermal growth factor receptor
1n8z.1.C	32.83	hetero-oligomer	BLAST	X-ray	2.52Å	0.38	0.39	Receptor protein-tyrosine kinase erbB-2
3c09.1.C	40.74	hetero-oligomer	HHblits	X-ray	3.20Å	0.41	0.37	Epidermal growth factor receptor
3c09.1.C	40.74	hetero-oligomer	BLAST	X-ray	3.20Å	0.41	0.37	Epidermal growth factor receptor
3i2t.1.A	30.81	homo-dimer	BLAST	X-ray	2.70Å	0.37	0.39	Epidermal growth factor receptor, isoform A
3p0y.1.A	27.13	hetero-oligomer	HHblits	X-ray	1.80Å	0.35	0.37	Epidermal growth factor receptor
3b2u.5.C	27.27	hetero-oligomer	HHblits	X-ray	2.58Å	0.35	0.37	Epidermal growth factor receptor
4krm.1.A	27.27	hetero-oligomer	HHblits	X-ray	2.65Å	0.35	0.37	Epidermal growth factor receptor
3p11.1.C	25.13	hetero-oligomer	HHblits	X-ray	3.70Å	0.34	0.37	Receptor tyrosine-protein kinase erbB-3
3c09.1.C	27.42	hetero-oligomer	HHblits	X-ray	3.20Å	0.35	0.37	Epidermal growth factor receptor
3p11.1.C	28.73	hetero-oligomer	BLAST	X-ray	3.70Å	0.36	0.36	Receptor tyrosine-protein kinase erbB-3
4xst.2.C	31.98	hetero-oligomer	HHblits	X-ray	3.00Å	0.35	0.34	Insulin receptor
4oga.1.E	31.98	hetero-oligomer	HHblits	X-ray	3.50Å	0.35	0.34	Insulin receptor domains L1-CR
4xss.1.B	31.98	hetero-oligomer	HHblits	X-ray	3.00Å	0.35	0.34	Insulin receptor
3u2p.1.A	24.42	monomer	HHblits	X-ray	2.57Å	0.34	0.34	Receptor tyrosine-protein kinase erbB-4
1mox.1.A	23.26	hetero-oligomer	HHblits	X-ray	2.50Å	0.34	0.34	Epidermal Growth Factor Receptor
1mox.1.B	23.26	hetero-oligomer	HHblits	X-ray	2.50Å	0.34	0.34	Epidermal Growth Factor Receptor
3h3b.1.A	26.16	hetero-oligomer	HHblits	X-ray	2.45Å	0.34	0.34	Receptor tyrosine-protein kinase erbB-2
3h3b.2.A	26.16	hetero-oligomer	HHblits	X-ray	2.45Å	0.34	0.34	Receptor tyrosine-protein kinase erbB-2
2a91.1.A	25.58	monomer	HHblits	X-ray	2.50Å	0.33	0.34	Receptor tyrosine-protein kinase erbB-2
4hrl.1.A	25.73	hetero-oligomer	HHblits	X-ray	2.55Å	0.33	0.34	Receptor tyrosine-protein kinase erbB-2
3c09.1.C	35.14	hetero-oligomer	BLAST	X-ray	3.20Å	0.39	0.29	Epidermal growth factor receptor
3p0y.1.A	35.14	hetero-oligomer	BLAST	X-ray	1.80Å	0.39	0.29	Epidermal growth factor receptor
4krm.1.A	35.14	hetero-oligomer	BLAST	X-ray	2.65Å	0.39	0.29	Epidermal growth factor receptor
3b2u.5.C	35.14	hetero-oligomer	BLAST	X-ray	2.58Å	0.39	0.29	Epidermal growth factor receptor
3loh.1.E	28.19	hetero-oligomer	HHblits	X-ray	3.80Å	0.33	0.29	Insulin receptor
2dtg.1.E	28.38	hetero-oligomer	HHblits	X-ray	3.80Å	0.33	0.29	Insulin receptor
1igr.1.A	30.07	monomer	HHblits	X-ray	2.60Å	0.34	0.28	INSULIN-LIKE GROWTH FACTOR RECEPTOR 1
2ahx.1.A	34.85	monomer	BLAST	X-ray	2.40Å	0.40	0.26	Receptor tyrosine-protein kinase erbB-4
2ahx.2.A	34.85	monomer	BLAST	X-ray	2.40Å	0.40	0.26	Receptor tyrosine-protein kinase erbB-4
3u7u.4.A	34.85	hetero-oligomer	BLAST	X-ray	3.03Å	0.40	0.26	Receptor tyrosine-protein kinase erbB-4
3u7u.3.A	34.85	hetero-oligomer	BLAST	X-ray	3.03Å	0.40	0.26	Receptor tyrosine-protein kinase erbB-4
3u7u.2.A	34.85	hetero-oligomer	BLAST	X-ray	3.03Å	0.40	0.26	Receptor tyrosine-protein kinase erbB-4
3u7u.1.A	34.85	hetero-oligomer	BLAST	X-ray	3.03Å	0.40	0.26	Receptor tyrosine-protein kinase erbB-4
3u9u.3.A	34.85	monomer	BLAST	X-ray	3.42Å	0.40	0.26	Receptor tyrosine-protein kinase erbB-4
3u9u.4.A	34.85	monomer	BLAST	X-ray	3.42Å	0.40	0.26	Receptor tyrosine-protein kinase erbB-4
3w14.1.E	30.37	hetero-oligomer	HHblits	X-ray	4.40Å	0.34	0.27	INSULIN RECEPTOR DOMAINS L1-CR-L2-(FNIII-1)-ALPHACT
2hr7.1.B	29.63	homo-dimer	HHblits	X-ray	2.32Å	0.33	0.27	Insulin receptor
2hr7.1.A	29.63	homo-dimer	HHblits	X-ray	2.32Å	0.33	0.27	Insulin receptor
3w11.1.E	30.60	hetero-oligomer	HHblits	X-ray	3.90Å	0.34	0.26	Insulin receptor domains L1-CR
4li2.1.B	23.33	hetero-oligomer	HHblits	X-ray	3.19Å	0.32	0.18	R-spondin-1
4kng.1.C	23.33	hetero-oligomer	HHblits	X-ray	2.50Å	0.32	0.18	R-spondin-1
4cdk.4.B	23.08	hetero-oligomer	HHblits	X-ray	2.80Å	0.31	0.18	R-SPONDIN-1
4cdk.3.B	23.08	hetero-oligomer	HHblits	X-ray	2.80Å	0.31	0.18	R-SPONDIN-1
4cdk.2.B	23.08	hetero-oligomer	HHblits	X-ray	2.80Å	0.31	0.18	R-SPONDIN-1
4bsu.1.D	23.08	hetero-oligomer	HHblits	X-ray	3.20Å	0.31	0.18	R-SPONDIN-1
4bso.1.A	23.08	monomer	HHblits	X-ray	2.20Å	0.31	0.18	R-SPONDIN-1
4bst.1.D	23.08	hetero-oligomer	HHblits	X-ray	4.30Å	0.31	0.18	R-SPONDIN-1
4bst.1.C	23.08	hetero-oligomer	HHblits	X-ray	4.30Å	0.31	0.18	R-SPONDIN-1
4bss.2.D	23.08	hetero-oligomer	HHblits	X-ray	3.20Å	0.31	0.18	R-SPONDIN-1
4bss.2.C	23.08	hetero-oligomer	HHblits	X-ray	3.20Å	0.31	0.18	R-SPONDIN-1
4bss.1.D	23.08	hetero-oligomer	HHblits	X-ray	3.20Å	0.31	0.18	R-SPONDIN-1
4bss.1.C	23.08	hetero-oligomer	HHblits	X-ray	3.20Å	0.31	0.18	R-SPONDIN-1
4bsr.1.D	23.08	hetero-oligomer	HHblits	X-ray	3.20Å	0.31	0.18	R-SPONDIN-1
4bsr.1.C	23.08	hetero-oligomer	HHblits	X-ray	3.20Å	0.31	0.18	R-SPONDIN-1
4bsp.1.A	23.08	monomer	HHblits	X-ray	2.00Å	0.31	0.18	R-SPONDIN-1
4bsu.1.C	23.08	hetero-oligomer	HHblits	X-ray	3.20Å	0.31	0.18	R-SPONDIN-1
4cdk.1.B	23.08	hetero-oligomer	HHblits	X-ray	2.80Å	0.31	0.18	R-SPONDIN-1
4c99.1.B	22.47	hetero-oligomer	HHblits	X-ray	2.80Å	0.31	0.18	R-SPONDIN-2
4c99.1.D	22.47	hetero-oligomer	HHblits	X-ray	2.80Å	0.31	0.18	R-SPONDIN-2
4c9e.2.D	23.86	hetero-oligomer	HHblits	X-ray	3.00Å	0.31	0.17	R-SPONDIN-2
4c9e.2.B	23.86	hetero-oligomer	HHblits	X-ray	3.00Å	0.31	0.17	R-SPONDIN-2
4c9e.1.D	23.86	hetero-oligomer	HHblits	X-ray	3.00Å	0.31	0.17	R-SPONDIN-2
4c9e.1.B	23.86	hetero-oligomer	HHblits	X-ray	3.00Å	0.31	0.17	R-SPONDIN-2
4c9a.1.D	23.86	hetero-oligomer	HHblits	X-ray	2.40Å	0.31	0.17	R-SPONDIN-2
4c9a.1.B	23.86	hetero-oligomer	HHblits	X-ray	2.40Å	0.31	0.17	R-SPONDIN-2
4c8w.1.A	23.86	monomer	HHblits	X-ray	3.10Å	0.31	0.17	R-SPONDIN-2
4c8v.8.A	23.86	monomer	HHblits	X-ray	2.20Å	0.31	0.17	R-SPONDIN-2
4c8v.2.A	23.86	monomer	HHblits	X-ray	2.20Å	0.31	0.17	R-SPONDIN-2
4c8v.1.A	23.86	monomer	HHblits	X-ray	2.20Å	0.31	0.17	R-SPONDIN-2
4c9r.1.B	23.86	hetero-oligomer	HHblits	X-ray	2.10Å	0.31	0.17	R-SPONDIN-2
4c9r.1.D	23.86	hetero-oligomer	HHblits	X-ray	2.10Å	0.31	0.17	R-SPONDIN-2
4c9u.1.B	23.86	hetero-oligomer	HHblits	X-ray	3.00Å	0.31	0.17	R-SPONDIN-2
4c9u.2.B	23.86	hetero-oligomer	HHblits	X-ray	3.00Å	0.31	0.17	R-SPONDIN-2
4c9v.1.B	23.86	hetero-oligomer	HHblits	X-ray	2.70Å	0.31	0.17	R-SPONDIN-2
4c8v.7.A	23.86	monomer	HHblits	X-ray	2.20Å	0.31	0.17	R-SPONDIN-2
4c8v.6.A	23.86	monomer	HHblits	X-ray	2.20Å	0.31	0.17	R-SPONDIN-2
4c8v.5.A	23.86	monomer	HHblits	X-ray	2.20Å	0.31	0.17	R-SPONDIN-2
4c8v.4.A	23.86	monomer	HHblits	X-ray	2.20Å	0.31	0.17	R-SPONDIN-2
4c8v.3.A	23.86	monomer	HHblits	X-ray	2.20Å	0.31	0.17	R-SPONDIN-2
4kng.1.C	23.17	hetero-oligomer	HHblits	X-ray	2.50Å	0.34	0.16	R-spondin-1
4li2.1.B	23.17	hetero-oligomer	HHblits	X-ray	3.19Å	0.34	0.16	R-spondin-1
4ufs.1.B	20.73	hetero-oligomer	HHblits	X-ray	4.80Å	0.30	0.16	R-SPONDIN-2
4ufr.1.D	20.73	hetero-oligomer	HHblits	X-ray	2.20Å	0.30	0.16	R-SPONDIN-2
4ufr.1.B	20.73	hetero-oligomer	HHblits	X-ray	2.20Å	0.30	0.16	R-SPONDIN-2
4cdk.3.B	23.38	hetero-oligomer	HHblits	X-ray	2.80Å	0.34	0.15	R-SPONDIN-1
4cdk.4.B	23.38	hetero-oligomer	HHblits	X-ray	2.80Å	0.34	0.15	R-SPONDIN-1
4cdk.1.B	23.38	hetero-oligomer	HHblits	X-ray	2.80Å	0.34	0.15	R-SPONDIN-1
4cdk.2.B	23.38	hetero-oligomer	HHblits	X-ray	2.80Å	0.34	0.15	R-SPONDIN-1
4bsu.1.D	23.38	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.15	R-SPONDIN-1
4bso.1.A	23.38	monomer	HHblits	X-ray	2.20Å	0.34	0.15	R-SPONDIN-1
4bst.1.D	23.38	hetero-oligomer	HHblits	X-ray	4.30Å	0.34	0.15	R-SPONDIN-1
4bst.1.C	23.38	hetero-oligomer	HHblits	X-ray	4.30Å	0.34	0.15	R-SPONDIN-1
4bss.2.D	23.38	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.15	R-SPONDIN-1
4bss.2.C	23.38	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.15	R-SPONDIN-1
4bss.1.D	23.38	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.15	R-SPONDIN-1
4bss.1.C	23.38	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.15	R-SPONDIN-1
4bsr.1.D	23.38	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.15	R-SPONDIN-1
4bsr.1.C	23.38	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.15	R-SPONDIN-1
4bsp.1.A	23.38	monomer	HHblits	X-ray	2.00Å	0.34	0.15	R-SPONDIN-1
4bsu.1.C	23.38	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.15	R-SPONDIN-1
4qxf.2.B	22.50	hetero-oligomer	HHblits	X-ray	2.25Å	0.31	0.16	R-spondin-1
4qxf.1.B	22.50	hetero-oligomer	HHblits	X-ray	2.25Å	0.31	0.16	R-spondin-1
2ivf.1.B	26.32	hetero-oligomer	HHblits	X-ray	1.88Å	0.34	0.15	ETHYLBENZENE DEHYDROGENASE BETA-SUBUNIT
3tje.1.C	21.79	hetero-oligomer	HHblits	X-ray	1.93Å	0.31	0.15	Tumor necrosis factor receptor superfamily member 6
3thm.1.C	21.79	hetero-oligomer	HHblits	X-ray	2.10Å	0.31	0.15	Tumor necrosis factor receptor superfamily member 6
4qxf.2.B	24.32	hetero-oligomer	HHblits	X-ray	2.25Å	0.34	0.15	R-spondin-1
4qxf.1.B	24.32	hetero-oligomer	HHblits	X-ray	2.25Å	0.34	0.15	R-spondin-1
1d4v.1.B	21.33	hetero-oligomer	HHblits	X-ray	2.20Å	0.31	0.15	DEATH RECEPTOR 5
4n90.3.A	23.29	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.14	Tumor necrosis factor receptor superfamily member 10B
4n90.2.A	23.29	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.14	Tumor necrosis factor receptor superfamily member 10B
4n90.1.A	23.29	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.14	Tumor necrosis factor receptor superfamily member 10B
2h9g.1.C	22.22	hetero-oligomer	HHblits	X-ray	2.32Å	0.31	0.14	Tumor necrosis factor receptor superfamily member 10B precursor
1d0g.1.C	22.22	hetero-oligomer	HHblits	X-ray	2.40Å	0.31	0.14	DEATH RECEPTOR-5
1d0g.1.A	22.22	hetero-oligomer	HHblits	X-ray	2.40Å	0.31	0.14	DEATH RECEPTOR-5
1du3.2.C	22.22	hetero-oligomer	HHblits	X-ray	2.20Å	0.31	0.14	DEATH RECEPTOR 5
1du3.2.B	22.22	hetero-oligomer	HHblits	X-ray	2.20Å	0.31	0.14	DEATH RECEPTOR 5
1du3.1.C	22.22	hetero-oligomer	HHblits	X-ray	2.20Å	0.31	0.14	DEATH RECEPTOR 5
1du3.1.A	22.22	hetero-oligomer	HHblits	X-ray	2.20Å	0.31	0.14	DEATH RECEPTOR 5
2p6a.1.B	19.72	hetero-oligomer	HHblits	X-ray	3.40Å	0.32	0.14	Follistatin
2p6a.1.D	19.72	hetero-oligomer	HHblits	X-ray	3.40Å	0.32	0.14	Follistatin
4i9x.1.C	22.86	hetero-oligomer	HHblits	X-ray	2.10Å	0.32	0.14	Tumor necrosis factor receptor superfamily member 10B
4i9x.1.D	22.86	hetero-oligomer	HHblits	X-ray	2.10Å	0.32	0.14	Tumor necrosis factor receptor superfamily member 10B
1za3.1.C	21.43	hetero-oligomer	HHblits	X-ray	3.35Å	0.31	0.14	Tumor necrosis factor receptor superfamily member 10B
4mxw.2.D	16.18	hetero-oligomer	HHblits	X-ray	3.60Å	0.27	0.13	Tumor necrosis factor receptor superfamily member 3
4mxw.1.A	16.18	hetero-oligomer	HHblits	X-ray	3.60Å	0.27	0.13	Tumor necrosis factor receptor superfamily member 3
4c9v.1.B	28.81	hetero-oligomer	HHblits	X-ray	2.70Å	0.36	0.12	R-SPONDIN-2
4c8v.1.A	28.81	monomer	HHblits	X-ray	2.20Å	0.36	0.12	R-SPONDIN-2
4c8v.2.A	28.81	monomer	HHblits	X-ray	2.20Å	0.36	0.12	R-SPONDIN-2
4c8v.3.A	28.81	monomer	HHblits	X-ray	2.20Å	0.36	0.12	R-SPONDIN-2
4c8v.4.A	28.81	monomer	HHblits	X-ray	2.20Å	0.36	0.12	R-SPONDIN-2
4c8v.5.A	28.81	monomer	HHblits	X-ray	2.20Å	0.36	0.12	R-SPONDIN-2
4c8v.6.A	28.81	monomer	HHblits	X-ray	2.20Å	0.36	0.12	R-SPONDIN-2
4c8v.7.A	28.81	monomer	HHblits	X-ray	2.20Å	0.36	0.12	R-SPONDIN-2
4c8v.8.A	28.81	monomer	HHblits	X-ray	2.20Å	0.36	0.12	R-SPONDIN-2
4c8w.1.A	28.81	monomer	HHblits	X-ray	3.10Å	0.36	0.12	R-SPONDIN-2
4c9a.1.B	28.81	hetero-oligomer	HHblits	X-ray	2.40Å	0.36	0.12	R-SPONDIN-2
4c9a.1.D	28.81	hetero-oligomer	HHblits	X-ray	2.40Å	0.36	0.12	R-SPONDIN-2
4c9e.1.B	28.81	hetero-oligomer	HHblits	X-ray	3.00Å	0.36	0.12	R-SPONDIN-2
4c9e.1.D	28.81	hetero-oligomer	HHblits	X-ray	3.00Å	0.36	0.12	R-SPONDIN-2
4c9e.2.B	28.81	hetero-oligomer	HHblits	X-ray	3.00Å	0.36	0.12	R-SPONDIN-2
4c9e.2.D	28.81	hetero-oligomer	HHblits	X-ray	3.00Å	0.36	0.12	R-SPONDIN-2
4c9r.1.B	28.81	hetero-oligomer	HHblits	X-ray	2.10Å	0.36	0.12	R-SPONDIN-2
4c9r.1.D	28.81	hetero-oligomer	HHblits	X-ray	2.10Å	0.36	0.12	R-SPONDIN-2
4c9u.1.B	28.81	hetero-oligomer	HHblits	X-ray	3.00Å	0.36	0.12	R-SPONDIN-2
4c9u.2.B	28.81	hetero-oligomer	HHblits	X-ray	3.00Å	0.36	0.12	R-SPONDIN-2
4c99.1.B	27.12	hetero-oligomer	HHblits	X-ray	2.80Å	0.34	0.12	R-SPONDIN-2
4c99.1.D	27.12	hetero-oligomer	HHblits	X-ray	2.80Å	0.34	0.12	R-SPONDIN-2
2hev.1.B	17.19	hetero-oligomer	HHblits	X-ray	2.41Å	0.27	0.13	Tumor necrosis factor receptor superfamily member 4
2hey.2.B	17.19	hetero-oligomer	HHblits	X-ray	2.00Å	0.27	0.13	Tumor necrosis factor receptor superfamily member 4
2hey.1.B	17.19	hetero-oligomer	HHblits	X-ray	2.00Å	0.27	0.13	Tumor necrosis factor receptor superfamily member 4
4ufs.1.B	27.27	hetero-oligomer	HHblits	X-ray	4.80Å	0.34	0.11	R-SPONDIN-2
4ufr.1.D	27.27	hetero-oligomer	HHblits	X-ray	2.20Å	0.34	0.11	R-SPONDIN-2
4ufr.1.B	27.27	hetero-oligomer	HHblits	X-ray	2.20Å	0.34	0.11	R-SPONDIN-2
2aw2.1.B	19.30	hetero-oligomer	HHblits	X-ray	2.80Å	0.30	0.11	Tumor necrosis factor receptor superfamily member 14
4j38.1.B	15.25	hetero-oligomer	HHblits	X-ray	2.83Å	0.26	0.12	Complement factor H
3thm.1.C	23.08	hetero-oligomer	HHblits	X-ray	2.10Å	0.33	0.10	Tumor necrosis factor receptor superfamily member 6
3tje.1.C	23.08	hetero-oligomer	HHblits	X-ray	1.93Å	0.33	0.10	Tumor necrosis factor receptor superfamily member 6
2vpz.1.B	28.57	hetero-oligomer	HHblits	X-ray	2.40Å	0.36	0.10	NRFC PROTEIN
2g7i.1.A	12.50	homo-tetramer	HHblits	X-ray	1.75Å	0.25	0.11	Complement factor H
4hrn.1.C	33.33	hetero-oligomer	HHblits	X-ray	2.65Å	0.41	0.09	Receptor tyrosine-protein kinase erbB-2
1srz.1.A	16.98	monomer	HHblits	NMR	NA	0.28	0.10	Gamma-aminobutyric acid type B receptor, subunit 1
1ss2.1.A	16.98	monomer	HHblits	NMR	NA	0.28	0.10	Gamma-aminobutyric acid type B receptor, subunit 1
3egw.1.B	24.49	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.10	Respiratory nitrate reductase 1 beta chain
3wvt.1.A	25.00	monomer	HHblits	X-ray	1.60Å	0.34	0.09	ELR1
1kqf.1.B	20.83	hetero-oligomer	HHblits	X-ray	1.60Å	0.31	0.09	FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, IRON-SULFUR SUBUNIT
1d4v.1.B	19.15	hetero-oligomer	HHblits	X-ray	2.20Å	0.31	0.09	DEATH RECEPTOR 5
1za3.1.C	22.22	hetero-oligomer	HHblits	X-ray	3.35Å	0.32	0.09	Tumor necrosis factor receptor superfamily member 10B
2hev.1.B	15.91	hetero-oligomer	HHblits	X-ray	2.41Å	0.29	0.09	Tumor necrosis factor receptor superfamily member 4
2hey.2.B	15.91	hetero-oligomer	HHblits	X-ray	2.00Å	0.29	0.09	Tumor necrosis factor receptor superfamily member 4
2hey.1.B	15.91	hetero-oligomer	HHblits	X-ray	2.00Å	0.29	0.09	Tumor necrosis factor receptor superfamily member 4
1du3.2.C	21.95	hetero-oligomer	HHblits	X-ray	2.20Å	0.33	0.08	DEATH RECEPTOR 5
1du3.1.A	21.95	hetero-oligomer	HHblits	X-ray	2.20Å	0.33	0.08	DEATH RECEPTOR 5
1du3.1.C	21.95	hetero-oligomer	HHblits	X-ray	2.20Å	0.33	0.08	DEATH RECEPTOR 5
1du3.2.B	21.95	hetero-oligomer	HHblits	X-ray	2.20Å	0.33	0.08	DEATH RECEPTOR 5
4i9x.1.D	21.95	hetero-oligomer	HHblits	X-ray	2.10Å	0.33	0.08	Tumor necrosis factor receptor superfamily member 10B
4i9x.1.C	21.95	hetero-oligomer	HHblits	X-ray	2.10Å	0.33	0.08	Tumor necrosis factor receptor superfamily member 10B
4n90.3.A	21.95	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.08	Tumor necrosis factor receptor superfamily member 10B
4n90.2.A	21.95	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.08	Tumor necrosis factor receptor superfamily member 10B
4n90.1.A	21.95	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.08	Tumor necrosis factor receptor superfamily member 10B
2h9g.1.C	21.95	hetero-oligomer	HHblits	X-ray	2.32Å	0.33	0.08	Tumor necrosis factor receptor superfamily member 10B precursor
1d0g.1.C	21.95	hetero-oligomer	HHblits	X-ray	2.40Å	0.33	0.08	DEATH RECEPTOR-5
1d0g.1.A	21.95	hetero-oligomer	HHblits	X-ray	2.40Å	0.33	0.08	DEATH RECEPTOR-5
4od2.1.C	23.68	hetero-oligomer	HHblits	X-ray	3.20Å	0.33	0.07	Tumor necrosis factor receptor superfamily member 10B
4mxw.1.A	17.95	hetero-oligomer	HHblits	X-ray	3.60Å	0.31	0.08	Tumor necrosis factor receptor superfamily member 3
4mxw.2.D	17.95	hetero-oligomer	HHblits	X-ray	3.60Å	0.31	0.08	Tumor necrosis factor receptor superfamily member 3
4kt1.1.B	28.57	hetero-oligomer	HHblits	X-ray	2.50Å	0.37	0.07	R-spondin-1
4kt1.1.B	28.57	hetero-oligomer	HHblits	X-ray	2.50Å	0.34	0.07	R-spondin-1
4hrn.1.C	30.00	hetero-oligomer	HHblits	X-ray	2.65Å	0.40	0.06	Receptor tyrosine-protein kinase erbB-2
3ij2.1.B	21.43	hetero-oligomer	HHblits	X-ray	3.75Å	0.33	0.06	Nerve growth factor receptor (TNFR superfamily, member 16)
2vpz.1.B	26.92	hetero-oligomer	HHblits	X-ray	2.40Å	0.38	0.05	NRFC PROTEIN
1sg1.1.C	20.00	hetero-oligomer	HHblits	X-ray	2.40Å	0.32	0.05	Tumor necrosis factor receptor superfamily member 16
3buk.1.C	20.00	hetero-oligomer	HHblits	X-ray	2.60Å	0.32	0.05	Tumor necrosis factor receptor superfamily member 16
1y4z.1.B	31.82	hetero-oligomer	HHblits	X-ray	2.00Å	0.36	0.04	Respiratory nitrate reductase 1 beta chain
1pc5.1.A	28.57	monomer	HHblits	X-ray	1.80Å	0.37	0.04	Ferredoxin I
1y5l.1.B	33.33	hetero-oligomer	HHblits	X-ray	2.50Å	0.37	0.04	Respiratory nitrate reductase 1 beta chain
1fdn.1.A	38.89	monomer	HHblits	X-ray	1.84Å	0.44	0.04	FERREDOXIN
1b0v.1.A	25.00	monomer	HHblits	X-ray	2.80Å	0.35	0.04	PROTEIN (FERREDOXIN)
2fgo.1.A	38.89	monomer	HHblits	X-ray	1.32Å	0.43	0.04	Ferredoxin
1f5c.1.A	25.00	monomer	HHblits	X-ray	1.75Å	0.34	0.04	FERREDOXIN 1
1e08.1.A	27.78	hetero-oligomer	HHblits	theoretical	NA	0.42	0.04	[FE]-HYDROGENASE (LARGE SUBUNIT)
1gx7.1.A	27.78	hetero-oligomer	HHblits	theoretical	NA	0.42	0.04	PERIPLASMIC [FE] HYDROGENASE LARGE SUBUNIT
1blu.1.A	33.33	monomer	HHblits	X-ray	2.10Å	0.41	0.04	FERREDOXIN
1dur.1.A	33.33	monomer	HHblits	X-ray	2.00Å	0.40	0.04	2[4FE-4S] FERREDOXIN
1fd2.1.A	20.00	monomer	HHblits	X-ray	1.90Å	0.32	0.04	FERREDOXIN
1rgv.1.A	38.89	monomer	HHblits	X-ray	2.90Å	0.40	0.04	ferredoxin
2zvs.3.A	33.33	monomer	HHblits	X-ray	1.65Å	0.40	0.04	Uncharacterized ferredoxin-like protein yfhL
2zvs.2.A	33.33	monomer	HHblits	X-ray	1.65Å	0.40	0.04	Uncharacterized ferredoxin-like protein yfhL
2zvs.1.A	33.33	monomer	HHblits	X-ray	1.65Å	0.40	0.04	Uncharacterized ferredoxin-like protein yfhL
1clf.1.A	27.78	monomer	HHblits	NMR	NA	0.39	0.04	FERREDOXIN
3exy.1.A	33.33	monomer	HHblits	X-ray	1.48Å	0.39	0.04	Ferredoxin
1fca.1.A	35.29	monomer	HHblits	X-ray	1.80Å	0.41	0.03	FERREDOXIN
2z8q.1.A	37.50	monomer	HHblits	X-ray	1.70Å	0.44	0.03	Ferredoxin
2z8q.2.A	37.50	monomer	HHblits	X-ray	1.70Å	0.44	0.03	Ferredoxin
4dhv.1.B	37.50	homo-dimer	HHblits	X-ray	1.95Å	0.44	0.03	Ferredoxin
4dhv.1.A	37.50	homo-dimer	HHblits	X-ray	1.95Å	0.44	0.03	Ferredoxin
1wtf.1.A	37.50	monomer	HHblits	X-ray	1.60Å	0.43	0.03	Ferredoxin
1f2g.1.A	46.67	monomer	HHblits	NMR	NA	0.44	0.03	FERREDOXIN II
1fxd.1.A	46.67	homo-dimer	HHblits	X-ray	1.70Å	0.44	0.03	FERREDOXIN II
1vjw.1.A	40.00	monomer	HHblits	X-ray	1.75Å	0.44	0.03	FERREDOXIN(A)
1rof.1.A	40.00	monomer	HHblits	NMR	NA	0.44	0.03	FERREDOXIN
1dfd.1.A	31.25	monomer	HHblits	NMR	NA	0.39	0.03	FERREDOXIN I
1dax.1.A	31.25	monomer	HHblits	NMR	NA	0.39	0.03	FERREDOXIN I
1fxr.1.A	31.25	homo-dimer	HHblits	X-ray	2.30Å	0.39	0.03	FERREDOXIN I
1fxr.1.B	31.25	homo-dimer	HHblits	X-ray	2.30Å	0.39	0.03	FERREDOXIN I
4ov1.1.A	25.00	monomer	HHblits	X-ray	2.31Å	0.33	0.03	Putative ferredoxin